127854-APC
HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase) (APC)
Size
£927.00
- SKU:
- 127854-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-350 from human HIF1AN (AAH07719) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Factor inhibiting HIF-1 (FIH1) is an Fe (II)- dependent hydroxylase enzyme that serves as an oxygen sensor in the hypoxia response pathway. FIH1 binds to HIF-1alpha and inhibits its transactivation function. It also binds to VHL, which too functions as a transcriptional corepressor that inhibits HIF-1alpha transactivation function. In addition, FIH1 regulates the Notch signaling output and plays a role in how Notch signaling modulates the hypoxic response. It negatively regulates Notch activity and accelerates myogenic differentiation. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice