127847
HHLA3 (HERV-H LTR-associating Protein 3, Human Endogenous Retrovirus-H Long Terminal Repeat-associating Protein 3)
Size
£685.00
- SKU:
- 127847
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-54 from HHLA3 (NP_009002) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- The function of this protein remains unknown but it may be involved in protein binding. There are 3 isoforms produced by alternative splicing. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice