HES5 (Transcription Factor HES-5, Class B Basic Helix-loop-helix Protein 38, bHLHb38, Hairy and Enhancer of Split 5, BHLHB38)

Size

£685.00

SKU:: 127813
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa28-121 from human HES5 (NP_001010926) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcriptional repressor of genes that require a bHLH protein for their transcription. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.