127802-FITC

Hepatoma Derived Growth Factor (HDGF, DKFZp686J1764, FLJ96580, High-Mobility Group Protein 1-Like 2, HMG1L2, HMG-1L2) (FITC)

Size

£914.00

SKU:: 127802-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa184-240 from human HDGF (NP_004485) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: HDGF is a member of the hepatoma-derived growth factor family. This protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.