HECW2 (KIAA1301, NEDL2, E3 Ubiquitin-protein Ligase HECW2, HECT, C2 and WW Domain-containing Protein 2, NEDD4-like E3 Ubiquitin-protein Ligase 2, DKFZp686M17164)

Size

£685.00

SKU:: 127790
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa637-746 from human HECW2 (NP_065811) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5H1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: E3 ubiquitin-protein ligase that mediates ubiquitination of TP73. Acts to stabilize TP73 and enhance activation of transcription by TP73. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DLECADSSCNESVTTQLSSVDTRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQESVCTAGSLPVVQVPSGEDEGPGAESATVPDQEELGEVWQRRGSLEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.