127776-APC

HDAC9 (Histone Deacetylase 9, HD9, Histone Deacetylase 7B, HD7, HD7b, Histone Deacetylase-related Protein, MEF2-interacting Transcription Repressor MITR, HDAC7, HDAC7B, HDRP, KIAA0744, MITR) (APC)

Size

£927.00

SKU:: 127776-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa481-570 from HDAC9 (NP_478056) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G10
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: HDAC-9 is a histone deacetylase with an important role in the regulation of gene expression and hematopoiesis. A nuclear protein, HDAC-9 belongs to the histone deacetylase family with several isoforms and is inhibited by Trichostatin A (TSA) and suberoylanilide hydroxamic acid. It helps in deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) and gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. MEF2-dependent transcription is repressed by HDAC-9 by recruiting HDAC-1 and/or HDAC-3. It also inhibits skeletal myogenesis and is involved in heart development. Ubiquitous but variable expression is seen in brain and other tissues like heart, pancreas and also in human bladder carcinoma cells. Lack of HDAC-9 protein is found in a family with Peters anomaly, a central corneal leukoma. Applications: Suitable for use in FLISA and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQAA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice