HDAC5 (HD5, FLJ90614, KIAA0600, Antigen NY-CO-9, Histone Deacetylase 5)

Size

£685.00

SKU:: 127766
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa330-429 from HDAC5 (AAH51824) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Human HDAC5 is composed of 1122aa residues. The deacetylase domain of HDAC5 is located at the C-terminal half of the molecule. The N-terminal non-deacetylase domain does not show any significant homology with any published sequence. Both domains are required for HDAC5-mediated repression of gene transcription. HDAC5 interacts with a growing number of transcriptional factors including MEF2A as well as other HDAC proteins. The interacting complexes bind to specific regions of chromatin and regulate gene transcription in these regions. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice