127766-BIOTIN
HDAC5 (HD5, FLJ90614, KIAA0600, Antigen NY-CO-9, Histone Deacetylase 5) (Biotin)
Size
£914.00
- SKU:
- 127766-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa330-429 from HDAC5 (AAH51824) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Human HDAC5 is composed of 1122aa residues. The deacetylase domain of HDAC5 is located at the C-terminal half of the molecule. The N-terminal non-deacetylase domain does not show any significant homology with any published sequence. Both domains are required for HDAC5-mediated repression of gene transcription. HDAC5 interacts with a growing number of transcriptional factors including MEF2A as well as other HDAC proteins. The interacting complexes bind to specific regions of chromatin and regulate gene transcription in these regions. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice