127743
HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase)
Size
£685.00
- SKU:
- 127743
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human HCCS, aa1-268 (AAH01691.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- The precursor of cytochrome c, apocytochrome c, is synthesized in the cytoplasm. Upon translocation into mitochondria, cytochrome c acquires a heme moiety required for functionality in the mitochondrial respiration chain. The heme-bound form of cytochrome c is called holocytochrome c. When released into the cytosol, cytochrome c can activate caspases responsible for apoptosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice