HAPLN4 (BRAL2, KIAA1926, Hyaluronan and Proteoglycan Link Protein 4, Brain Link Protein 2)

Size

£685.00

SKU:: 127726
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa30-134 from human HAPLN4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: HAPLN4 binds to hyaluronic acid and may be involved in formation of the extracellular matrix (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.