HAGH (GLO2, HAGH1, HydroxyacylGlutathione Hydrolase, Mitochondrial, Glyoxalase II)

Size

£698.00

SKU:: 127712
Purity:: Ascites
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa161-260 from human HAGH (NP_005317) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F9
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.