127711-ML550
HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-CoA Dehydrogenase, SCHAD) (MaxLight 550)
Size
£914.00
- SKU:
- 127711-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa205-314 from human HADHSC (NP_005318) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. HADH, which belongs to the family of oxidoreductases, is important for converting certain fats to energy. This protein is an enzyme that catalyzes the chemical reaction. ((S)-3-hydroxyacyl-CoA + NAD+ <=>3-oxoacyl-CoA + NADH + H+ ) It is also involved in a process called fatty acid oxidation, in which several enzymes work in a step-wise fashion to break down (metabolize) fats and convert them to energy. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice