127711-FITC

HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-CoA Dehydrogenase, SCHAD) (FITC)

Size

£914.00

SKU:: 127711-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa205-314 from human HADHSC (NP_005318) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: HADH, which belongs to the family of oxidoreductases, is important for converting certain fats to energy. This protein is an enzyme that catalyzes the chemical reaction. ((S)-3-hydroxyacyl-CoA + NAD+ <=>3-oxoacyl-CoA + NADH + H+ ) It is also involved in a process called fatty acid oxidation, in which several enzymes work in a step-wise fashion to break down (metabolize) fats and convert them to energy. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice