GYG1 (Glycogenin 1, Glycogenin-1, GN-1, GN1, GYG)

Size

£685.00

SKU:: 127684
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-73 from human GYG1 (NP_004121) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Glycogenin 1 is an enzyme involved in glycogen biosynthesis. Glycogenin 1 is important for the function of self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase. Also, it plays a role in regulating glycogen metabolism and the attainment of maximal glycogen levels in skeletal muscle. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.