GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1)

Size

£685.00

SKU:: 127674
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa41-141 from human GUCY1A3 (AAH28384) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.