GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522)

Size

£685.00

SKU:: 127583
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Glutathione reductase (GSR or GR) is a crucial flavoenzyme in the antioxidant defense system that maintains high levels of reduced glutathione in the cytosol. It belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family and is a flavoprotein homodimer of two equal subunits with one mole of noncovalently bound FAD in each subunit. GR reduces glutathione disulphide (GSSG) to the sulfhydryl form (GSH) which is an important cellular oxidant and is used by glutathione peroxidase to detoxify hydrogen peroxide. Apart from NADPH, GR also uses FAD as a cofactor for the process. In sperm, GR and glutathione peroxidase function as antioxidant enzymes and thus may inhibit lipid peroxidation. GR is stimulated by melatonin and is reportedly irreversibly inhibited by a number of oxygen radical generating systems. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice