127583-BIOTIN

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)

Size

£914.00

SKU:: 127583-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Glutathione reductase (GSR or GR) is a crucial flavoenzyme in the antioxidant defense system that maintains high levels of reduced glutathione in the cytosol. It belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family and is a flavoprotein homodimer of two equal subunits with one mole of noncovalently bound FAD in each subunit. GR reduces glutathione disulphide (GSSG) to the sulfhydryl form (GSH) which is an important cellular oxidant and is used by glutathione peroxidase to detoxify hydrogen peroxide. Apart from NADPH, GR also uses FAD as a cofactor for the process. In sperm, GR and glutathione peroxidase function as antioxidant enzymes and thus may inhibit lipid peroxidation. GR is stimulated by melatonin and is reportedly irreversibly inhibited by a number of oxygen radical generating systems. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice