127579-BIOTIN
GSK3B (Glycogen Synthase Kinase-3 beta, GSK-3 beta, Serine/Threonine-protein Kinase GSK3B) (Biotin)
Size
£914.00
- SKU:
- 127579-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-100 from human GSK3B (NP_002084) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1H3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Glycogen synthase kinase 3 (GSK-3) is a serine/threonine protein kinase that has been implicated in the regulation of cell fate and in the Wnt signaling pathway. GSK-3 plays an important role in the PI3 kinase and Akt mediated cell survival pathways, and its activity can be inhibited by Akt-mediated phosphorylation at Ser21 of GSK-3a and Ser9 of GSK-3b. GSK-3 has also been implicated in alzheimer's disease. Six Tau protein isoforms have been identified, all of which are phosphorylated by GSK-3. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice