127526-BIOTIN

GRAP2 (GRB2 Related Adaptor Protein 2, GRAP-2, GADS, GRB2-like Protein, GRB2L, GRBLG, GrbX, Grf40 Adapter Protein, Grf-40, GRID, Growth Factor Receptor Binding Protein, GRPL, Mona, p38, SH3-SH2-SH3 Adapter Mona) (Biotin)

Size

£914.00

SKU:: 127526-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa226-315 from GRAP2 (AAH25692) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.