127521-BIOTIN
Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (Biotin)
Size
£914.00
- SKU:
- 127521-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa148-247 from human GZMB (AAH30195) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4F5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T lymphocytes (CTL) and in natural killer (NK) cells. Both granzyme A and granzyme B are synthesized as inactive proenzymes that are stored within cytolytic granules and released by effector cells during degradation. Granzyme B should be useful for localization of granzyme B-containing lytic granules and characterization of activated CTLs or NK cells. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice