GPS2 (G-Protein Pathway Suppressor 2, GPS-2, MGC104294, MGC119287, MGC119288, MGC119289)

Size

£685.00

SKU:: 127508
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa228-327 from human GPS2 (AAH13652) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GPS2 (G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signaling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.