GPR89 (G-Protein-coupled Receptor 89A, GPR89A, GPR89B, CGI-13, FLJ10492, FLJ11696, FLJ36909, FLJ79270, Golgi pH Regulator A, GPHRA, MGC688, MGC87324, Protein GPR89A, Putative MAPK-activating Protein PM01, Putative NF-kappa-B-activating Protein 90, SH120, UNQ192/PRO218)

Size

£685.00

SKU:: 127502
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa175-285 from human GPR89 (AAH03187) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GPR89 may be involved in the NF-kappa-B and MAPK signaling pathways Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.