127502-BIOTIN

GPR89 (G-Protein-coupled Receptor 89A, GPR89A, GPR89B, CGI-13, FLJ10492, FLJ11696, FLJ36909, FLJ79270, Golgi pH Regulator A, GPHRA, MGC688, MGC87324, Protein GPR89A, Putative MAPK-activating Protein PM01, Putative NF-kappa-B-activating Protein 90, SH120, UNQ192/PRO218) (Biotin)

Size

£914.00

SKU:: 127502-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa175-285 from human GPR89 (AAH03187) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: GPR89 may be involved in the NF-kappa-B and MAPK signaling pathways Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.