GPR154 (Neuropeptide S Receptor, G-protein Coupled Receptor 154, G-protein Coupled Receptor PGR14, G-protein Coupled Receptor for Asthma Susceptibility, NPSR1, GPRA, PGR14)

Size

£685.00

SKU:: 127493
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa2-53 of human GPR154 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Sandwich ELISA (capture antibody): The detection limit is ~0.03ng/ml. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.