GOLPH4 (Golgi Phosphoprotein 4, Golgi Integral Membrane Protein 4, GOLIM4, Golgi Integral Membrane Protein cis, GIMPC, Golgi-localized Phosphoprotein of 130kD, Golgi Phosphoprotein of 130kD, GPP130, P138)

Size

£685.00

SKU:: 127467
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa473-568 from human GOLPH4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5E11
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.