GOLGB1 (Golgin Subfamily B Member 1, 372kD Golgi Complex-associated Protein, GCP372, Giantin, Macrogolgin)

Size

£685.00

SKU:: 127462
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa3-91 from human GOLGB1 (NP_004478) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May participate in forming intercisternal cross-bridges of the Golgi complex. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.