GMFB (Glia Maturation Factor beta, GMF-beta)

Size

£685.00

SKU:: 127397
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-154 from human GMFB (AAH05359) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G12-2A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GMFB, also known as GMF, belongs to the GMF subfamily of the larger actin-binding protein ADF family. This protein, which is phosphorylated following phorbol ester stimulation, is important for the nervous system. It causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. Overexpression of GMFB in astrocytes has been shown to enhance brain-derived neurotrohic factor (BDNF) production. GMFB expression is increased by exercise, and the protein is crucial for exercise-induction of BDNF. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice