GLYAT (ACGNAT, CAT, GAT, Glycine N-acyltransferase, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, Benzoyl-coenzyme A:glycine N-acyltransferase, Glycine N-benzoyltransferase, HRP-1(CLP))

Size

£685.00

SKU:: 127374
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length human GLYAT, aa1-163 (AAH09785.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.