GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1)

Size

£685.00

SKU:: 127352
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa121-220 from human GLRA1 (NP_000162) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Glycine receptor is a neurotransmitter-gated ion channel. When bound to its ligand, glycine, chloride conductance is increased and consequently inhibits neuronal firing. It is a pentameric receptor composed of alpha and beta subunits and localises to the cell junction, synapse and postsynaptic cell membrane. Defects in GLRA1 cause startle disease (STHE) which is also known as hereditary hyperekplexia or congenital stiff-person syndrome. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.