127352-ML550
GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1) (MaxLight 550)
Size
£914.00
- SKU:
- 127352-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa121-220 from human GLRA1 (NP_000162) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Glycine receptor is a neurotransmitter-gated ion channel. When bound to its ligand, glycine, chloride conductance is increased and consequently inhibits neuronal firing. It is a pentameric receptor composed of alpha and beta subunits and localises to the cell junction, synapse and postsynaptic cell membrane. Defects in GLRA1 cause startle disease (STHE) which is also known as hereditary hyperekplexia or congenital stiff-person syndrome. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice