GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296)

Size

£685.00

SKU:: 127309
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa186-285 from human GIMAP5 (NP_060854) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GIMAP5 is a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLMLLHYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.