127297-APC
GHR (Growth Hormone Receptor, GH Receptor, Somatotropin Receptor) (APC)
Size
£927.00
- SKU:
- 127297-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa19-118 from human GHR (NP_000154) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A12
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- The GHR locus to human chromosome 5p13.1-p12 and to mouse chromosome 15. Additionally, its gene has 9 exons that encode the receptor and several additional exons in the 5-prime untranslated region. The coding exons span at least 87kb. GHR consists of an extracellular domain of 246aa, a single transmembrane domain, and a cytoplasmic domain. Exons 3 to 7 encode the extracellular domain. There are 2 isoforms of GHR in humans, generated by retention or exclusion of exon 3 during splicing: a full-length isoform and an isoform that lacks exon 3 (d3GHR). Furthermore, the two isoforms of GHR are expressed in the placenta and appeared to be due to alternative splicing. In cirrhosis, there is a state of acquired GH resistance, as defined by high circulating GH levels with low IGF1 levels. Moreover, mutations in the GHR gene have been demonstrated as the cause of Laron syndrome , also known as the growth hormone insensitivity syndrome (GHIS). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice