GGPS1 (Geranylgeranyl Pyrophosphate Synthetase, GGPP Synthetase, GGPPSASE, Geranylgeranyl Diphosphate Synthase)

Size

£685.00

SKU:: 127286
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa201-300 from GGPS1 (NP_004828) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Geranylgeranyl diphosphate (GGPP) synthase (GGPS) catalyzes the synthesis of GGPP, a molecule responsible for the C20-prenylation of protein and for the regulation of a nuclear hormone receptor. The deduced 300aa human protein contains 5 conserved domains consistent with prenyltransferases. Recombinant GGPS shows enzymatic properties associated with the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. Mouse GGPS is regulated in several tissues in obesity and is induced during adipocyte differentiation. GGPS is increased 5- to 20-fold in skeletal muscle, liver, and fat of ob/ob mice. Western blot analysis detects a 2-fold overexpression of protein in muscle and fat but not in liver. Differentiation of mouse fibroblasts into adipocytes induces GGPS expression more than 20-fold. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice