127281-PE

GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (PE)

Size

£914.00

SKU:: 127281-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa32-119 from human GFRA1 (NP_005255) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRa, which is a cell surface receptor for GDNF. The cDNA encoding GDNFRa from human, rat, chicken and mouse have been cloned recently. GDNFRa was also termed Ret ligand 1 (RETL1) or TGF-b-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRa-1 recently. GFRa-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRa and the Ret PTK from a complex to transduce GDNF signal and to mediate GDNF function. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice