127281-BIOTIN

GFRA1 (GDNF Family Receptor alpha-1, GDNF Receptor alpha-1, GDNFR-alpha-1, GFR-alpha-1, RET Ligand 1, TGF-beta-related Neurotrophic Factor Receptor 1, GDNFRA, RETL1, TRNR1) (Biotin)

Size

£914.00

SKU:: 127281-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa32-119 from human GFRA1 (NP_005255) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRa, which is a cell surface receptor for GDNF. The cDNA encoding GDNFRa from human, rat, chicken and mouse have been cloned recently. GDNFRa was also termed Ret ligand 1 (RETL1) or TGF-b-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFRa-1 recently. GFRa-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFRa and the Ret PTK from a complex to transduce GDNF signal and to mediate GDNF function. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice