Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3)

Size

£685.00

SKU:: 127271
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa110-209 from human GMNN (AAH05185) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Geminin inhibits DNA replication by preventing the incorporation of MCM complex into the prereplication complex (pre-RC). It is absent during the G1 phase, accumulates during the S, G2, and M phases, and disappears during the metaphase-anaphase transition. Geminin contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice