127271-ML490
Geminin (GMNN, GEM, Geminin DNA Replication Inhibitor, DNA Replication Inhibitor, RP3-369A17.3) (MaxLight 490)
Size
£914.00
- SKU:
- 127271-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa110-209 from human GMNN (AAH05185) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Geminin inhibits DNA replication by preventing the incorporation of MCM complex into the prereplication complex (pre-RC). It is absent during the G1 phase, accumulates during the S, G2, and M phases, and disappears during the metaphase-anaphase transition. Geminin contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice