GDF7 (Growth/Differentiation Factor 7, GDF-7, BMP12)

Size

£685.00

SKU:: 127254
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa361-451 from human GDF7 (NP_878248) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May play an active role in the motor area of the primate neocortex. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.