GCSF (Granulocyte Colony-stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33)

Size

£685.00

SKU:: 127245
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa31-207 from human CSF3 (NP_757373).
Clone:: 2C5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Granulocyte-colony Stimulating Factor (G-CSF) is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. G-CSF signals via the G-CSF receptor, a heavily glycosylated 812aa polypeptide with a single transmembrane domain. Stimulation of the G-CSFR results in the activation of the Ras/MAPK pathway and phosphorylation of the adaptor protein Shc. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.