GCM1 (Glial Cells Missing Homolog 1, GCM Motif Protein 1, Chorion-specific Transcription Factor GCMa, GCMa)

Size

£685.00

SKU:: 127235
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa108-166 from GCM1 (NP_003634) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). This protein is a homolog of the Drosophila glial cells missing gene (gcm). It binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.