127230-HRP

GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (HRP)

Size

£914.00

SKU:: 127230-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa528-637 from human GCLC (NP_001489) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene for catalytic subunit (GLCLC) encodes a protein of 367aa with a calculated molecular weight of 72.773kD and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p21-p22. GLCLC deficiency in human is associated with enzymopathic hemolytic anemia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice