127230-BIOTIN
GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (Biotin)
Size
£914.00
- SKU:
- 127230-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa528-637 from human GCLC (NP_001489) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene for catalytic subunit (GLCLC) encodes a protein of 367aa with a calculated molecular weight of 72.773kD and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p21-p22. GLCLC deficiency in human is associated with enzymopathic hemolytic anemia. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice