GBX2 (Homeobox Protein GBX-2, Gastrulation and Brain-specific Homeobox Protein 2)

Size

£685.00

SKU:: 127213
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa114-182 from human GBX2 (NM_001485, NP_001476) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Homeobox protein GBX-2 may act as a transcription facctor for pluripotency and differentiation in the embryo. It localises to the nucleus. The unprocessed precursor is 348aa long and has an estimated molecular weight of ~37KD. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.