GATAD2B (Transcriptional Repressor p66-beta, GATA Zinc Finger Domain-containing Protein 2B, p66/p68, KIAA1150, FLJ37346, MGC138257, MGC138285, P66beta, RP11-216N14.6)

Size

£685.00

SKU:: 127191
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa3-111 from human GATAD2B (NP_065750) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcriptional repressor. Enhances MBD2-mediated repression. Efficient repression requires the presence of GATAD2A. Targets MBD3 to discrete loci in the nucleus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.