GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1)

Size

£685.00

SKU:: 127182
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa123-199 from human GATA1 (NM_002049) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GATA1 is the founding member of a family of transcription factors distinguished by a zinc finger domain that recognizes the DNA consensus motif (A/T)GATA(A/G). Functionally important GATA motifs have been identified in the regulatory regions of virtually all erythroid-expressed genes, including globins, heme biosynthetic enzymes, erythroid transcription factors and erythroid membrane proteins. GATA1 is thus a DNA-binding protein, essential for the survival and maturation of lineage-committed erythroid precursors. GATA1 is required for normal erythropoiesis. Human GATA1 gene is mapped to chromosomal region Xp11.23. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice