127182-FITC

GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (FITC)

Size

£914.00

SKU:: 127182-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa123-199 from human GATA1 (NM_002049) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: GATA1 is the founding member of a family of transcription factors distinguished by a zinc finger domain that recognizes the DNA consensus motif (A/T)GATA(A/G). Functionally important GATA motifs have been identified in the regulatory regions of virtually all erythroid-expressed genes, including globins, heme biosynthetic enzymes, erythroid transcription factors and erythroid membrane proteins. GATA1 is thus a DNA-binding protein, essential for the survival and maturation of lineage-committed erythroid precursors. GATA1 is required for normal erythropoiesis. Human GATA1 gene is mapped to chromosomal region Xp11.23. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice