GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3)

Size

£685.00

SKU:: 127176
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa595-694 from human GAS2L3 (AAH43366) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GAS2L3 (Growth arrest-specific 2 like 3) a member of the GAS2 family, is similar in sequence to the mouse protein GAS2, an actin-associated protein expressed at high levels in growth-arrested cells. The specific function of this protein is unknown. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SAFQKTGPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.