GAP43 (Neuromodulin, Axonal Membrane Protein GAP-43, Growth-associated Protein 43, Neural Phosphoprotein B-50, pp46)

Size

£685.00

SKU:: 127157
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human GAP43, aa1-238 (AAH07936).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: GAP43 is expressed by developing and regenerating neurons, and to a lesser extent, reactive glial cells.It is used widely to specifically label injured neurons and to score neuronal regeneration. GAP43 is also a neuronal growth cone protein thought to be involved in pathfinding. GAP43 is considered to be a crucial component of an effective regenerative response in the nervous system. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.