GAGE5 (G Antigen 5, GAGE-5, Cancer/Testis Antigen 4.5, CT4.5)

Size

£685.00

SKU:: 127098
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa28-117 from human GAGE5 (NP_001466.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Expressed in a variety of tumor tissues but not in normal tissues, except testis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.