127093-APC
GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (APC)
Size
£927.00
- SKU:
- 127093-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa76-165 from human GADD45A (AAH11757) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- GADD45A responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45A gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice